Protein Info for Pf1N1B4_2985 in Pseudomonas fluorescens FW300-N1B4

Annotation: DNA-binding response regulator GltR, controls specific porins for the entry of glucose

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 105.6 bits, see alignment E=1.6e-34 PF00486: Trans_reg_C" amino acids 156 to 229 (74 residues), 77.7 bits, see alignment E=5.7e-26

Best Hits

Swiss-Prot: 44% identical to OMPR_SALTI: Transcriptional regulatory protein OmpR (ompR) from Salmonella typhi

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 84% identity to pfl:PFL_4997)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P280 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Pf1N1B4_2985 DNA-binding response regulator GltR, controls specific porins for the entry of glucose (Pseudomonas fluorescens FW300-N1B4)
VNSLLIVDDDLEVLDLLKKFFMQHGYSVEVATDGASLWAAIERQAPDLIILDVMLPGDSG
LILCQQLRIRHAIPVIMLTAMGELSDRVVGLELGADDYLTKPFDARELLARVRAVLRRVD
ERRPVPQERPRPLIDFADWHLDVTRRELRSPDNVMIPLSAGEFDLLLVFVEHPQRILTRE
QLLDLARGHCHEAFDRSIDVQVSRLRRKLESDTKRPAMIRTVRNGGYLFTPSVTRR