Protein Info for Pf1N1B4_2975 in Pseudomonas fluorescens FW300-N1B4

Annotation: Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10518: TAT_signal" amino acids 1 to 20 (20 residues), 24 bits, see alignment (E = 2.7e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 23 (21 residues), 19 bits, see alignment (E = 1.3e-07) TIGR00357: methionine-R-sulfoxide reductase" amino acids 47 to 170 (124 residues), 170.6 bits, see alignment E=1.7e-54 PF01641: SelR" amino acids 51 to 169 (119 residues), 173.5 bits, see alignment E=1.6e-55

Best Hits

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P1Y7 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Pf1N1B4_2975 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Pseudomonas fluorescens FW300-N1B4)
MFSRRQFLVASGGLGAAALVVGVLPKFSASVSLIDEARAEEVFEVTHSDSEWRAKLSAEQ
YEILREEGTERAYSSPLNNEHRKGVFACAGCDLPLFSSDTKFDSRTGWPSFWAPLDNAVA
TRQDRSFGVLREEVHCRRCGGHLGHVFEDGPKPTGLRYCMNGLALTFKPQA