Protein Info for Pf1N1B4_2920 in Pseudomonas fluorescens FW300-N1B4

Annotation: Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17827: PrmC_N
  • amino acids 10 to 72 (63 residues), 69.3 bits, E=1.2e-22
• TIGR00536: methyltransferase, HemK family
  • amino acids 18 to 273 (256 residues), 257.7 bits, E=1.2e-80
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 22 to 270 (249 residues), 300.3 bits, E=1.1e-93
• PF03602: Cons_hypoth95
  • amino acids 91 to 188 (98 residues), 29.1 bits, E=2.6e-10
• PF06325: PrmA
  • amino acids 101 to 182 (82 residues), 27.1 bits, E=1e-09
• PF05175: MTS
  • amino acids 102 to 189 (88 residues), 61.9 bits, E=2.1e-20
• PF13489: Methyltransf_23
  • amino acids 102 to 236 (135 residues), 27.2 bits, E=1e-09
• PF13847: Methyltransf_31
  • amino acids 110 to 192 (83 residues), 41.3 bits, E=4.9e-14
• PF13649: Methyltransf_25
  • amino acids 112 to 182 (71 residues), 31.6 bits, E=8e-11

Best Hits

Swiss-Prot: 73% identical to PRMC_PSEAE: Release factor glutamine methyltransferase (prmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 93% identity to pfo:Pfl01_4747)

MetaCyc: 51% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

See A0A166P0Z4 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Pf1N1B4_2920 Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2 (Pseudomonas fluorescens FW300-N1B4)
MTIIASLLRAADLPDSPTARLDAELLLAAALGKSRSFLHTWPERIVPSEAALKFAEYLQR
RRSGEPVAYILGQQGFWKLDLEVAPHTLIPRPDTELLVETALELLPATPARVLDLGTGSG
AIALALASERPAWKVTAVDRVLEAVALAERNRQRLHLNNATVLSSHWFSALEGQRFQLII
SNPPYIASTDPHLAEGDVRFEPASALVAGVDGLDDLRLIVDQAPDHLEAGGWLMLEHGYD
QAEAVRDLLLTRGFAEVHSRTDLGGHERISLGRLPC