Protein Info for Pf1N1B4_2912 in Pseudomonas fluorescens FW300-N1B4

Annotation: GTP-binding and nucleic acid-binding protein YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00092: GTP-binding protein YchF" amino acids 1 to 366 (366 residues), 522.8 bits, see alignment E=2.4e-161 PF02421: FeoB_N" amino acids 5 to 45 (41 residues), 29.4 bits, see alignment 7.8e-11 PF01926: MMR_HSR1" amino acids 5 to 110 (106 residues), 73.7 bits, see alignment E=2e-24 PF06071: YchF-GTPase_C" amino acids 282 to 365 (84 residues), 139 bits, see alignment E=6.8e-45

Best Hits

KEGG orthology group: K06942, (no description) (inferred from 95% identity to pst:PSPTO_1101)

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166P0T0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Pf1N1B4_2912 GTP-binding and nucleic acid-binding protein YchF (Pseudomonas fluorescens FW300-N1B4)
MGFNCGIVGLPNVGKSTLFNALTKSGIAAENFPFCTIEPNTGIVPMPDPRLEALAAIVNP
KRILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAHVVRCFEDENVIHVSNSVD
PKRDIEIIDLELIFADLDSCEKQLQKVARNAKGGDKDAVVQKALLEQLIAHFTLGKPART
LMKNMGADDKAVIRGFHLLTTKPVMYIANVAEDGFENNPLLDIVKAIAEEEGAMVVPVCN
KIEAEIAELEDGEEKDMFLEALGLEEPGLNRVIRAGYEMLHLQTYFTAGVEEVRAWTVRV
GATAPQAAGVIHTDFEKGFIRAEVIAYDDFIQYKGEAGTKEAGKWRLEGKDYIVKDGDVM
HFRFNV