Protein Info for Pf1N1B4_2839 in Pseudomonas fluorescens FW300-N1B4

Annotation: Dephospho-CoA kinase (EC 2.7.1.24)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 5 to 181 (177 residues), 226.5 bits, E=1e-71
• TIGR00152: dephospho-CoA kinase
  • amino acids 6 to 189 (184 residues), 182.1 bits, E=4.9e-58

Best Hits

Swiss-Prot: 92% identical to COAE_PSEPF: Dephospho-CoA kinase (coaE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 92% identity to pfo:Pfl01_4823)

MetaCyc: 50% identical to dephospho-CoA kinase (Escherichia coli K-12 substr. MG1655)
Dephospho-CoA kinase. [EC: 2.7.1.24]

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (4/5 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See A0A162BNS1 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Pf1N1B4_2839 Dephospho-CoA kinase (EC 2.7.1.24) (Pseudomonas fluorescens FW300-N1B4)
VEKPWILGLTGGIGSGKSAAAQHFIDLGVHVVDADHAARWVVEPGRPALAKIAEHFGPGV
LQADGQLDRAALRKLIFEVPDERRWLEALLHPLIAEEIVHHLAKAQSSYAILVSPLLIES
GQYAMTQRVLVIDAPEQLQIERTLQRDQTSEQQVQAILKAQSSRQDRVNHADDVVVNDRD
LAWLHSEVERLHHFYLTLRGGQS