Protein Info for Pf1N1B4_2819 in Pseudomonas fluorescens FW300-N1B4

Annotation: Two-component sensor PilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details PF00512: HisKA" amino acids 310 to 374 (65 residues), 62.2 bits, see alignment E=6e-21 PF02518: HATPase_c" amino acids 417 to 521 (105 residues), 70.2 bits, see alignment E=3e-23

Best Hits

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 84% identity to pfo:Pfl01_4839)

Predicted SEED Role

"Two-component sensor PilS" in subsystem Type IV pilus

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BNQ5 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Pf1N1B4_2819 Two-component sensor PilS (Pseudomonas fluorescens FW300-N1B4)
VIAETSSPGNKQAQRLLRLYHLYRLSIGITLVLLISSNMDSQLLTFANDDLLRNGSWLYL
VLNILLVVFLENTRRPAQLFGLALVDVLLLCGLFYAAGGMPSAIGNLLIVSVVISNTLLR
GRIGLLIAAVGALGIVGLSFLLSFSHPTSPNDYLQIGTLGALCFVAALLVQGLIRRVEVS
ETLAEQRASEVLGLEALNALILQRMRTGILVLDDQRRVQLANHSALTLLGQEKLDGQLID
DHSMPLVERLQLWFNNPTLRPQSLKIASNGLELQPSFIALDQSPHHQTLVFLEDLAQIAQ
QAQQLKLAALGRLTAGIAHEIRNPLGAISHAAQLLQESEELNGADRRLTQIIQDHSQRMN
RVIENVLQLSRRQQTVPQRLDLRPWLEHFVAETREGATERQLVHLRIGSGDFTTLMDPNQ
LTQILDNLLRNAWRHSALNHDQAQVWLELFIDPDSQLPTLEVLDNGPGVAPDQRSHLFEP
FFTTSSQGTGLGLYLSRELCESNQARLDFKPRQGGCFRITFAHGRKQS