Protein Info for Pf1N1B4_2806 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lipoprotein signal peptidase (EC 3.4.23.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 70 to 89 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 11 to 163 (153 residues), 132.5 bits, see alignment E=6.7e-43 PF01252: Peptidase_A8" amino acids 17 to 159 (143 residues), 147.1 bits, see alignment E=2.1e-47

Best Hits

Swiss-Prot: 95% identical to LSPA_PSEPF: Lipoprotein signal peptidase (lspA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 95% identity to pfo:Pfl01_4851)

MetaCyc: 44% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z8Q2 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Pf1N1B4_2806 Lipoprotein signal peptidase (EC 3.4.23.36) (Pseudomonas fluorescens FW300-N1B4)
MPNAVGRFGRLSWLWLSLLVLVIDQASKFYFEGSLSMYQQIVVIPDYFSWTLAYNTGAAF
SFLADSSGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGALGNLYDRIAL
GHVIDFILVHWQNRWYFPAFNFADSAISVGAVMLALDMFKSKKTGETVHD