Protein Info for Pf1N1B4_2719 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 182 to 204 (23 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 31 to 170 (140 residues), 143.9 bits, see alignment E=7.5e-46 PF07695: 7TMR-DISM_7TM" amino acids 183 to 385 (203 residues), 194.6 bits, see alignment E=4.9e-61 PF00512: HisKA" amino acids 418 to 482 (65 residues), 53.4 bits, see alignment E=5.5e-18 PF02518: HATPase_c" amino acids 529 to 642 (114 residues), 73.9 bits, see alignment E=3.6e-24 PF00072: Response_reg" amino acids 671 to 779 (109 residues), 64.8 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_4944)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NWW7 at UniProt or InterPro

Protein Sequence (794 amino acids)

>Pf1N1B4_2719 Sensor histidine kinase (Pseudomonas fluorescens FW300-N1B4)
MRYLLILLLCLPLLASAVEFDEFTQSLPLGRTMQVYEDAGGQATIADVRAQAAAGQFKPH
DKATLNAGYSRSAFWLKIDLHYRPTNPSAQRSWLLELAYPPLDHLDLYLPDAGGDYQLVR
QTGDALPFATREIRQNNYLFGLNFVPEQAQTVYLRLQSQGSVQAPVTLWSSTAYLEEQPV
RLYVLGLIYGVLLGMLVYNLFIFLSVRDTSYLYYIVYIASFGLYQLSVNGAAVEYFWPNN
PWWANAATPFFIGCSGLFGSQFARSFLQTATHSRWLDRLLLALIAFSALVVGLSLMTNYA
LALRLATLLALVFTVVIFAAGIFAWWRGLRVARYFIIAWSAFLLGGVVNTLMVLGYLPNV
FLTMYASQIGSAIEVALLSLALADRINAMREQQAQTLFDAGQKLEVLNQQLAHSNKLKDE
FLATLTHELRTPMNGVIGSLELMQTVEMNPELEQYQQTAAGSARDMMRMVNGILTLTELQ
AGKLKVYPDTFSLRSVVEALRLQFDGNASSKSLDFKVEVTSGLPDRLHGDSGKLTQCLEC
LLDNAIKFTRIGGLALRVTGKPVAPDRLALSFAVIDTGIGFTDLDEATLYQRFFQVDGSM
TREYGGLGVGLAICRQLVELLGGRLSHRSEPGRGSRFQLDVEFELPLPVVESAPAITRQT
TGLRLPQDCTVLLVDDNSINQLVMRGMLLKLGFRVRTADSGVAALDLLQRETVDAALLDC
QLPPLDGASICGRIRALPGCAELPVFMIAQSADRAYCPSDTLVDYLSKPVKFEDLQAALY
RRVLCPGQGESADS