Protein Info for Pf1N1B4_2668 in Pseudomonas fluorescens FW300-N1B4

Annotation: DedA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 19 to 47 (29 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 14 to 139 (126 residues), 78.2 bits, see alignment E=3.9e-26

Best Hits

Swiss-Prot: 42% identical to Y364_MYCTO: Uncharacterized membrane protein MT0380 (MT0380) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03975, membrane-associated protein (inferred from 94% identity to pfo:Pfl01_4994)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>Pf1N1B4_2668 DedA protein (Pseudomonas fluorescens FW300-N1B4)
VIFCETGLVVMPFLPGDSLLFIAGAVAAGGGMDPVLLGGLLMLAAILGDSTNYIIGRTAG
EKLFSNPNSKIFRRDYLQQTHDFYDKHGGKTVTLARFMPIIRTFAPFVAGVGKMPYPRFF
AFSVLGTILWVGGLVTLGYFFGNVPFIKKNLSLLVVGIILLSLLPMIISVIRSRLGHAAS
KAEPR