Protein Info for Pf1N1B4_2652 in Pseudomonas fluorescens FW300-N1B4

Annotation: 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00885: DMRL_synthase" amino acids 16 to 152 (137 residues), 191 bits, see alignment E=4.6e-61 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 16 to 151 (136 residues), 176.3 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 96% identical to RISB_PSEMY: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 94% identity to pau:PA14_11430)

MetaCyc: 56% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.78

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0B7DGR7 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Pf1N1B4_2652 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) (Pseudomonas fluorescens FW300-N1B4)
MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHGVSESDITIIRAPGAFE
IPLVAQKVAQKGEFAAIIALGAVIRGGTPHFEYVAGECTKGLAQVSMEFGVPVAFGVLTV
DSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK