Protein Info for Pf1N1B4_2646 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutamate synthase [NADPH] large chain (EC 1.4.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10294: Methyltransf_16
  • amino acids 62 to 168 (107 residues), 38.7 bits, E=3.7e-13
• PF05175: MTS
  • amino acids 71 to 149 (79 residues), 34.4 bits, E=6.8e-12
• PF13489: Methyltransf_23
  • amino acids 80 to 215 (136 residues), 29.5 bits, E=2.3e-10
• PF06325: PrmA
  • amino acids 81 to 153 (73 residues), 56.8 bits, E=1.1e-18
• PF13847: Methyltransf_31
  • amino acids 81 to 161 (81 residues), 27.4 bits, E=9.8e-10
• PF13649: Methyltransf_25
  • amino acids 85 to 153 (69 residues), 32.2 bits, E=5.9e-11
• PF08241: Methyltransf_11
  • amino acids 86 to 154 (69 residues), 25.7 bits, E=5.8e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a5043)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (244 amino acids)

>Pf1N1B4_2646 Glutamate synthase [NADPH] large chain (EC 1.4.1.13) (Pseudomonas fluorescens FW300-N1B4)
MIAPLDLQQALGELLGDAQLIACELPGTELKLWLIDGDNMDRAFSPEETRRILHEPPYWS
FCWASGLAVARYLAEHPQWVEGKRVLDFGAGSGVAAIAAVKAGALEVVACDLDPLAIAAC
RANAELNGVQLSYSTDFFTEADRFDLILVADVLYDRANLPLLDEFLSRGREALVADSRVR
DFRHPLYQRIEMLEAMTLPDLAEPEEFRHVSLYHARRGLPAKTSRQAAHHSMATPLSATP
HQAL