Protein Info for Pf1N1B4_2645 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG000875: Thioredoxin domain-containing protein EC-YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00085: Thioredoxin" amino acids 11 to 109 (99 residues), 93.7 bits, see alignment E=2.3e-30 TIGR01068: thioredoxin" amino acids 14 to 111 (98 residues), 103.5 bits, see alignment E=2.9e-34 PF13098: Thioredoxin_2" amino acids 26 to 108 (83 residues), 31.3 bits, see alignment E=7.7e-11 PF14559: TPR_19" amino acids 130 to 196 (67 residues), 44.8 bits, see alignment E=4.5e-15 PF14561: TPR_20" amino acids 201 to 290 (90 residues), 91.5 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 95% identity to pba:PSEBR_a5044)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z8E1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Pf1N1B4_2645 FIG000875: Thioredoxin domain-containing protein EC-YbbN (Pseudomonas fluorescens FW300-N1B4)
MSQETPYIFDATTADFDQSVIENSFHKPVLVDFWAEWCAPCKALMPMLQTIAESYQGELL
LAKVNCDIEQDIVARFGIRSLPTVVLFKDGQPVDGFAGAQPESAVRTMLEPHVQMPPPAA
ADPFEQAQTLFDDGRFADAEATLKVLLAEDNTNAKALILYARCLTERGELGEAQIVLDAV
KTDEHKAALAGAKAQIQFLGQARDLPDAADLKARLAKNPQDDEAVYQLAIQQLARQQYDA
ALDALLKLFIRNRSYSEGLPHKTLLQVFELLGNDHPLVTTYRRKLFAALY