Protein Info for Pf1N1B4_2637 in Pseudomonas fluorescens FW300-N1B4

Annotation: dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 96% identity to pfo:Pfl01_5031)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>Pf1N1B4_2637 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) (Pseudomonas fluorescens FW300-N1B4)
LINLAYYFDWFQAETVSEQRLAGQERAIERLAELCQHHNIVLLQPSSYRVFDGSRATAYS
EKDEPVPLGLRGQALWRIEQSVRATCPQHVLLRFGWLLDDSPDGTLGRFLARAEKAEELL
MADDRRGNPTPVDDAARVIISVLKQLDCAAPLWGTYHYAGHEATTPLALGQAILTEARAL
HPLAIEAPTAQAHAARPDAAEEPQHAVLACKKILHTFGIKPRAWRAALPGLLDRFYRHG