Protein Info for Pf1N1B4_2608 in Pseudomonas fluorescens FW300-N1B4

Annotation: LSU ribosomal protein L17p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00059: ribosomal protein bL17
  • amino acids 7 to 117 (111 residues), 151.9 bits, E=3.9e-49
• PF01196: Ribosomal_L17
  • amino acids 20 to 116 (97 residues), 128.7 bits, E=6.3e-42

Best Hits

Swiss-Prot: 98% identical to RL17_PSEF5: 50S ribosomal protein L17 (rplQ) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 97% identity to pba:PSEBR_a5072)

MetaCyc: 76% identical to 50S ribosomal subunit protein L17 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See A0A162BN23 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Pf1N1B4_2608 LSU ribosomal protein L17p (Pseudomonas fluorescens FW300-N1B4)
MRHRKSGRHLSRTSSHRKAMFQNMAVSLFEHELIKTTLPKAKELRRVAEPLITLAKTDSL
ANRRLAFDRTRSKAIVGKLFNDLGKRYATREGGYLRILKCGFRTGDNAPMAYVELVDRPV
GGEAVSAE