Protein Info for Pf1N1B4_2596 in Pseudomonas fluorescens FW300-N1B4
Annotation: SSU ribosomal protein S8p (S15Ae)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to RS8_PSEF5: 30S ribosomal protein S8 (rpsH) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 90% identity to avn:Avin_06390)Predicted SEED Role
"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (104 amino acids)
>Pf1N1B4_2596 SSU ribosomal protein S8p (S15Ae) (Pseudomonas fluorescens FW300-N1B4) MPSSTLKVAVAKVLKDEGYIAGYQISSEIKPLLSIELKYFEGRPVIEEVKRVSRPGLRQY KSVDDLPKVRGGLGVSIVSTNKGVMTDRAARAAGVGGEVLCTVF