Protein Info for Pf1N1B4_2528 in Pseudomonas fluorescens FW300-N1B4

Annotation: SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 7 to 260 (254 residues), 283.6 bits, see alignment E=6.5e-89 PF00398: RrnaAD" amino acids 7 to 259 (253 residues), 239 bits, see alignment E=2.5e-75

Best Hits

Swiss-Prot: 92% identical to RSMA_PSEF5: Ribosomal RNA small subunit methyltransferase A (rsmA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 94% identity to pfs:PFLU5578)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AV73 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Pf1N1B4_2528 SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182) (Pseudomonas fluorescens FW300-N1B4)
MTEHYQHRARKRFGQNFLHDAGVIDRILRSIHAKPEDRLLEIGPGQGALTEGLLNSGAQL
DVVELDKDLIPILNQQFASKSNFHLHQGDALKFDFNSLNAAPNSLRVVGNLPYNISTPLI
FHLLHNASLIRDMHFMLQKEVVERLAAGPGGGDWGRLSIMVQYHCRVEHLFNVGPGAFNP
PPKVDSAIVRLVPHAVLPHPAKDHKLLERVVREAFNQRRKTLRNTLKLLLSNTEIEAAGV
DGSLRPEQLDLAAFVRLADKLSEQVLHKPATD