Protein Info for Pf1N1B4_2503 in Pseudomonas fluorescens FW300-N1B4

Annotation: Coenzyme PQQ synthesis protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 812 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 11 to 713 (703 residues), 828.3 bits, see alignment E=3.6e-253 PF00675: Peptidase_M16" amino acids 19 to 137 (119 residues), 84.1 bits, see alignment E=1.9e-27 PF05193: Peptidase_M16_C" amino acids 180 to 323 (144 residues), 45.8 bits, see alignment E=1.4e-15 amino acids 613 to 734 (122 residues), 33.6 bits, see alignment E=7.1e-12 PF22455: PqqF_C_3" amino acids 462 to 586 (125 residues), 106.2 bits, see alignment E=2.5e-34 PF22456: PqqF-like_C_4" amino acids 655 to 754 (100 residues), 96.9 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 57% identical to PQQF_PSEPH: Coenzyme PQQ synthesis protein F (pqqF) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BMS3 at UniProt or InterPro

Protein Sequence (812 amino acids)

>Pf1N1B4_2503 Coenzyme PQQ synthesis protein F (Pseudomonas fluorescens FW300-N1B4)
MPALNHPRLHTETLANGLRVTLRHAPDLKRCAAALRVAAGSHDVPLAWPGLAHFLEHLLF
LGTERFPAGQGLMAYVQGHGGQVNARTSERTTDFFFELPPQAFNGGLERLSDMLAHPRMN
PDDQRREREVLHAEFVAWSRDATAQQQFALYDGLSAAHPLRAFHAGNRYSLPVPQPEFQQ
ALKDFYQRFYQTGQMTLSLAGPQNLDELKRMAQVFAVAIPSGEKVPQTKPTLLIDSSDNS
YQQAGERRLDLLFTFEALPDSSPEALAFLCHWLNAEKPGGLFAQLREHGLVDNLKATPLY
HYAGQALLHIEFTRPAHATQPDNVIGEQLLDWLGFFASHQDWAELREEYAALLQRQQQVS
SALQLARRDSEQLEAGLSEQGVVALKAILKQIGAVDNFTGQWQLPTPNPFLRAETPAPNA
GLIRGQTSAHRGLRTFAQDRSRIRRERSPMQFSQALPENTDQGAVYLRWRLEFAPHSRLQ
SNLENNLRMLREDARQAGVDFSFSASGNEWLLKMTGLQEPMPTVLEHALKELTKPDADFS
QEAPAAVALMPIRQLLKALPDLCHEHSVVSDDLQQLWSSARWDGLAAGLSAQTQAAMGLA
LSRIPGTADSQLTPPPSIRSQHLWNSVDTASSEHALLLFCPTATHDIADEAAWRLLAHVC
QTPFYQRLRVELQLGYAVFSGLRQLNGQTGLLFGVQSPSVAPLDLLEHIEQFLSELEGMI
ESIDDATFIAQRQALADQFDNIALPNAQAAELLWQGKLAGHSSDYLKHLPQAILMIDREA
LLAAAQRLNRADGGWRCLANGPCPTTLWQVAK