Protein Info for Pf1N1B4_2498 in Pseudomonas fluorescens FW300-N1B4

Annotation: Coenzyme PQQ synthesis protein F (EC 3.4.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 PF20434: BD-FAE" amino acids 377 to 566 (190 residues), 36.1 bits, see alignment E=1e-12 PF00326: Peptidase_S9" amino acids 400 to 606 (207 residues), 168 bits, see alignment E=4.2e-53 PF01738: DLH" amino acids 442 to 599 (158 residues), 28.7 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 79% identity to pba:PSEBR_a5170)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F (EC 3.4.99.-)" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.99.-

Use Curated BLAST to search for 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NS23 at UniProt or InterPro

Protein Sequence (610 amino acids)

>Pf1N1B4_2498 Coenzyme PQQ synthesis protein F (EC 3.4.99.-) (Pseudomonas fluorescens FW300-N1B4)
MNETHASSPKAEPLSAARAVAAGIDFAELQVGQHGLFWNEYRPEDAACRIWQWRDGQARC
LTPPTFSVRSRVYEYGGGAFCLTDDGLVFVNEADQQLYRQSLTGEAPEVLTSNECRYGDL
QFADGQVLAVEENRDKHRLVAIDLVDGQRHLLAEGADFYSAPTLSPDGQRLAWIEWNRPD
QPWTATRLMVAERQSDHTFAQPRCVAGDGDEESLQQPRFDDSGRLFCLTDRGGFWQPWVE
SGNGLSPLPSAAADHGPAPWQLGGCTWLPLGEDTYLASWTEGGFGRLGLCHGDGSCDDFT
GDYSRFRHLAQDARFIYCIAASPVSSSAIIAIDRETRQVNVLAGGIAPLPAEQISRPQTL
RYPSGSGEAHGFFYPAMTNDTKPPLVVFIHGGPTSACYPMFDPRIQYWAQRGFAVADLNY
RGSSGYGRAYRQALHLSWGDVDVEDACAVVAYLAERGLIDGDRAFIRGGSAGGYTTLCAL
AFHKVFRAGASLYGVSDPVALGRATHKFEGDYLDWLIGDPEQDAERYAARTPLLHANDIS
VPVIFFQGELDAVVVPQQTRDMVTALQDNGLLVEAHYYADERHGFRKAGNQAHALEQEWL
FYRRVMALAG