Protein Info for Pf1N1B4_2494 in Pseudomonas fluorescens FW300-N1B4

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 27 (2 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 193 to 209 (17 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 240 to 350 (111 residues), 83 bits, see alignment E=1e-27 PF00990: GGDEF" amino acids 242 to 353 (112 residues), 81.4 bits, see alignment E=3.2e-27 amino acids 370 to 409 (40 residues), 25.5 bits, see alignment 5.1e-10

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_5168)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NS16 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Pf1N1B4_2494 GGDEF domain protein (Pseudomonas fluorescens FW300-N1B4)
LLRSSAVRFSHFLPSLVLLLAGLAAAYVKDLNVFFTSLFNVLPTLVLLLGGAYCAVYRRQ
RELFLMVTVYIAYFLLDTQTDYYRDNGKVRDDAAVVFHLCCLLLPLLFGLFAAWQERTHL
FQDMVARFAVLLAFGSVALGLEQSYPQALLMWLSEIRWPALHGAWMSLIQLSYPVFIASF
LLLAWQYWRNPRPLHAAQLVGLLGLFWMLPKTFILPFTLNIMCSQVMLMIAAAVAHEAYQ
MAFRDELTGLPGRRALNERMQRLGRNYVLAMGDVDHFKKFNDTHGHDVGDQVLRLVASKL
SKISGGGRAYRYGGEEFALVFAGKTLEECMPHLEVIRESIATYNIQLRNQDNRPQDDQQG
RQRRAGSGASSVSVTVSIGVAERLEQRTPEEVLKSADQALYSAKGAGRNCVMAFGQNRRG
AVRMDAAAG