Protein Info for Pf1N1B4_2474 in Pseudomonas fluorescens FW300-N1B4

Annotation: RNA polymerase sigma-70 factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF04542: Sigma70_r2" amino acids 1 to 66 (66 residues), 48.9 bits, see alignment E=9.5e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 1 to 150 (150 residues), 66.6 bits, see alignment E=1.1e-22 PF08281: Sigma70_r4_2" amino acids 97 to 149 (53 residues), 54.9 bits, see alignment E=1.1e-18 PF04545: Sigma70_r4" amino acids 102 to 149 (48 residues), 27.8 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 46% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 92% identity to pfs:PFLU5627)

MetaCyc: 46% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z3E1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Pf1N1B4_2474 RNA polymerase sigma-70 factor, ECF subfamily (Pseudomonas fluorescens FW300-N1B4)
LYRDHRGWLLAWLRRNVACPQRAEDLSQDTFVRLLGRDELKAPREPRAFLVAIAKGLLFD
YFRRAALEQAYLTELMLVPEGEQPSVEEQQLILEDLKAIDRLLGKLSSKARAAFLYNRLD
GLGHAEIAQRLGVSVPRVRQYLAQGIRQCYIALYGEPV