Protein Info for Pf1N1B4_2421 in Pseudomonas fluorescens FW300-N1B4

Annotation: L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 173 (45 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details TIGR03416: choline ABC transporter, permease protein" amino acids 4 to 270 (267 residues), 423.8 bits, see alignment E=1.4e-131 PF00528: BPD_transp_1" amino acids 109 to 266 (158 residues), 101.3 bits, see alignment E=2.9e-33

Best Hits

Swiss-Prot: 44% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 99% identity to pba:PSEBR_a5244)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NQR5 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Pf1N1B4_2421 L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1) (Pseudomonas fluorescens FW300-N1B4)
MLIDQKIPLGQYIAGFVEWLTQNGASTFDAIAVSLETMIHGVTFALTWFNPLALIGLIAL
LAHFIQRKWGLTVFVIASFLLILNLGYWQETMETLAQVLFATLVCVLIGVPLGIVAAHKP
MFYTVMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVP
DELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV
VNALNTADIALGFEAGLAIVLLAIMLDRICKQPDAKVGGDA