Protein Info for Pf1N1B4_2391 in Pseudomonas fluorescens FW300-N1B4

Annotation: Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03562: MltA
  • amino acids 117 to 279 (163 residues), 197.9 bits, E=1.1e-62
• PF06725: 3D
  • amino acids 302 to 373 (72 residues), 82 bits, E=2.8e-27

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 92% identity to pfo:Pfl01_5273)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See A0A161Z7V9 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Pf1N1B4_2391 Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-) (Pseudomonas fluorescens FW300-N1B4)
MNSRFKAWRHNLAWTLPMVAVLAGCTGGDSSKPKTHALATYSSATWEALPAVSDNDLVAG
FGSWRSACTRLKADPVWGGTCAASANVQPTAKDIRGFLKQNLDVYGLRAANDNPNGLITG
YYEPVYPGSLTQTEEANIPVYGVPEDMIIVSLDSIYPELKGKRLRGRLEGRVLKPYDDAA
TIETNGVKAPVIAWLTDPMNLQFLQIQGSGRIQLDDGRQLRIGYADQNGHPYRPIGRWLV
DQGELKKEDVTMGAISTWAKANPARIPELLGSNPSYVFFTRNPDSNEGPRGSLNVPLTAG
YSAAVDRKVIPLGSLLWLSTTRPDGSALVRPVAAQDTGGAIAGEVRADLFWGTGDAAGQL
AGDMKQQGQIWMLWPKGAALPQVPQVADTL