Protein Info for Pf1N1B4_2378 in Pseudomonas fluorescens FW300-N1B4

Annotation: Amine oxidase [flavin-containing] (EC 1.4.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 28 to 269 (242 residues), 52.5 bits, E=3.2e-17
• PF12831: FAD_oxidored
  • amino acids 28 to 77 (50 residues), 32.9 bits, 2.6e-11
• PF00890: FAD_binding_2
  • amino acids 28 to 67 (40 residues), 30.3 bits, 1.4e-10
• PF00070: Pyr_redox
  • amino acids 28 to 61 (34 residues), 22.8 bits, see alignment (E = 6e-08)
• PF13450: NAD_binding_8
  • amino acids 30 to 64 (35 residues), 38.8 bits, see alignment (E = 5.2e-13)
• PF01593: Amino_oxidase
  • amino acids 35 to 450 (416 residues), 161.6 bits, E=2.2e-50

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 88% identity to pfo:Pfl01_5286)

Predicted SEED Role

"Amine oxidase [flavin-containing] (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• phenylethylamine degradation I (2/2 steps found)
• putrescine degradation III (3/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (5/9 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See A0A166NPW9 at UniProt or InterPro

Protein Sequence (591 amino acids)

>Pf1N1B4_2378 Amine oxidase [flavin-containing] (EC 1.4.3.4) (Pseudomonas fluorescens FW300-N1B4)
MSAGWLRACALVMLGLFSVSALAKDKTVIVVGGGLSGLTAAYELQNKGWQVTLLEAKPTL
GGRSGMATSEWIGNDKTQPVLNKYVSTFKLTTTPAPEFVRTPSYLIDGEYFTAADLATKQ
PATAEALKRYEKTLDDLARSIEDPQNPAANSTLFALDQINVSNWLDRLNLPATARQLVNQ
QIRTRYDEPSRLSLLYFAQQSRVYRGVADRDLRASRLPGGSPVLAQAFVKQLKTIKTSSP
VSSITQDKDGVTVKVGSVGYQADYVVLAVPLRALNKIQMTPALDAQHLGAIKGTNYGWRD
QIMLKFKTPVWESKARMSGEIYSNTGLGMLWVEPALKGGANVVINLSGDNARVMQAFGDK
QMVDQVLIRLHAFYPQARGSFTGYEIRRYSTDPSMGGAYLAFGPGQISKYWRLWERPLQR
VAFAGEHTDALYPGTLEGALRTGQRAASQVEDLAAGKSFEPAKVVPAATAAAAGAVAAKK
GNFFTNLFGGSDDKPEPAKAPVPAAPVAPAPAPVPAPTPAPAPVEAPKPAAPVKAEPARK
APAKAPVKKPAAKTESKKAPVKATVKKTEPVKKPAVNTAAKTPATTETKTQ