Protein Info for Pf1N1B4_2368 in Pseudomonas fluorescens FW300-N1B4

Annotation: Malonate transporter, MadL subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 21 to 21 (1 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details PF03817: MadL" amino acids 1 to 117 (117 residues), 157.1 bits, see alignment E=9.1e-51 TIGR00807: malonate transporter, MadL subunit" amino acids 1 to 122 (122 residues), 186 bits, see alignment E=1.5e-59

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_5295)

Predicted SEED Role

"Malonate transporter, MadL subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NPN1 at UniProt or InterPro

Protein Sequence (138 amino acids)

>Pf1N1B4_2368 Malonate transporter, MadL subunit (Pseudomonas fluorescens FW300-N1B4)
MIIYGVALLAICTLAGVIMGDMLGALLGVKSNVGGVGIAMILLICARLWMQKRGGMTKDC
EMGVGFWGAMYIPVVVAMAAQQNVVTALHGGPVAVLAAIGSVVLCGCTIALISRTHKGEP
LPDEPADITSVGAPAGGR