Protein Info for Pf1N1B4_2349 in Pseudomonas fluorescens FW300-N1B4

Annotation: Putative Holliday junction resolvase YggF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03652: RuvX
  • amino acids 6 to 137 (132 residues), 145.2 bits, E=7.8e-47
• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 7 to 137 (131 residues), 144.7 bits, E=8e-47

Best Hits

Swiss-Prot: 97% identical to YQGF_PSEPF: Putative pre-16S rRNA nuclease (Pfl01_5312) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 97% identity to pba:PSEBR_a5314)

MetaCyc: 52% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YggF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Sequence Analysis Tools

See A0A161Z7T3 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Pf1N1B4_2349 Putative Holliday junction resolvase YggF (Pseudomonas fluorescens FW300-N1B4)
MALRLILGFDYGTKQIGVAVGQVITGQARELCTLKAQNGIPDWNQVEALIKEWKPDAVVV
GLPLNMDGTPSDMCLRAEKFARRLNGRYNLPFYTHDERLTTFEAKGERLVRGGQKGSYRD
NPVDAIAAALLLQGWLDENTALFES