Protein Info for Pf1N1B4_233 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcription regulator [contains diacylglycerol kinase catalytic domain]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR03702: lipid kinase YegS" amino acids 10 to 300 (291 residues), 444.2 bits, see alignment E=1.8e-137 PF00781: DAGK_cat" amino acids 11 to 130 (120 residues), 87.5 bits, see alignment E=5.5e-29 TIGR00147: lipid kinase, YegS/Rv2252/BmrU family" amino acids 12 to 294 (283 residues), 189.7 bits, see alignment E=5.7e-60 PF19279: YegS_C" amino acids 152 to 291 (140 residues), 42.7 bits, see alignment E=5.1e-15

Best Hits

Swiss-Prot: 86% identical to YEGS_PSEPF: Probable lipid kinase YegS-like (Pfl01_3958) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07029, (no description) (inferred from 85% identity to pfo:Pfl01_3958)

Predicted SEED Role

"Transcription regulator [contains diacylglycerol kinase catalytic domain]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QGW6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Pf1N1B4_233 Transcription regulator [contains diacylglycerol kinase catalytic domain] (Pseudomonas fluorescens FW300-N1B4)
MGVAKMSERKALLILHGKQALNEEVRAAVEGKRQQGWKLAVRLTWEAGDAQRLVEEALTA
GYTHLIAGGGDGTLRDIAEAMAAHSTQASLVLLPLGTANDFARAAGVPLEPAQALDLLEA
VPRTIDLGEVGGQVFLNMATGGFGSQVTANTSEDLKKILGGAAYLFTGLSRFSELHAAYG
ELQGPDFHWRGELLALGIGNGRQAGGGHVLCPQALADDGLLDISILPAPQEVVGTLKDLL
ADGFGIDNMFVRARLPWVEIKVSEGLYINLDGEPLEGDSLRFSARPAALRVHLPEGSPLL
SVSNPANRPD