Protein Info for Pf1N1B4_232 in Pseudomonas fluorescens FW300-N1B4

Annotation: DNA-binding response regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF00072: Response_reg" amino acids 5 to 99 (95 residues), 78.1 bits, see alignment E=6e-26 PF00196: GerE" amino acids 137 to 191 (55 residues), 57.6 bits, see alignment E=7.8e-20

Best Hits

Swiss-Prot: 32% identical to VRAR_STAS1: Response regulator protein VraR (vraR) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_3957)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MI16 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf1N1B4_232 DNA-binding response regulator, LuxR family (Pseudomonas fluorescens FW300-N1B4)
VRALVLDIPGYAVIGEANDGSLLVEMVEQLSPDIILLDISMKETSGLEALQRLKRVRPQC
KVLILSMHTDPALIMQALESGAHGYLLKDTTATELEHALDALRNNERYLSPAIAHTVINQ
ALTRTQKNQTQTQDSHNLTARQLEILRLIVRGKSTREIANGLGLSIKTVETHRSQIMKRL
QIYDVAGLVLFAVREQIISLDD