Protein Info for Pf1N1B4_2295 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ferric iron ABC transporter, iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 9 to 336 (328 residues), 536 bits, see alignment E=1.6e-165 PF13531: SBP_bac_11" amino acids 26 to 283 (258 residues), 58.1 bits, see alignment E=2.4e-19 PF01547: SBP_bac_1" amino acids 33 to 278 (246 residues), 64.5 bits, see alignment E=3.5e-21 PF13416: SBP_bac_8" amino acids 41 to 279 (239 residues), 78 bits, see alignment E=2.1e-25 PF13343: SBP_bac_6" amino acids 91 to 308 (218 residues), 87 bits, see alignment E=3e-28

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 96% identity to pfo:Pfl01_5367)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NNH4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Pf1N1B4_2295 Ferric iron ABC transporter, iron-binding protein (Pseudomonas fluorescens FW300-N1B4)
MFKPLALAAAVLTAFSLNAFAAKTELTVYTALEAEQLKTYKEAFEKANPDVEIKWVRDST
GIITAKLLAEKARPQADAVWGLAASSLAILDQQGMLQSYAPKDLGKIGGNYRDAANPPAW
VGMDVWAATICFNTVEAEKQGLTKPVSWQDLTKPEYKGKIVMPNPASSGTGFLDVSAWLQ
TFGEKQGWQYMDDLHQNIGQYVHSGSKPCKLAAAGEFPIGISFEYPAVQLKRQGAPLDII
LPKEGLGWEIEATAVIKGTPHEDAAKKLADFSASPAAMELYKENFAVLAQPGIAKPQTEL
PADYEQRLIKNDFAWASKNRDQILTEWRKRYDGKSEKVAAK