Protein Info for Pf1N1B4_2233 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 270 to 296 (27 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 443 to 466 (24 residues), see Phobius details amino acids 500 to 519 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 57 to 240 (184 residues), 51.8 bits, see alignment E=4.2e-18 amino acids 351 to 512 (162 residues), 31.5 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 94% identity to pfl:PFL_5963)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NMK2 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Pf1N1B4_2233 Ferric iron ABC transporter, permease protein (Pseudomonas fluorescens FW300-N1B4)
LVFAIAALVLLPLSVLLFSWQIIDQQIWSHLWDTQMPRLLGNTLTLVLGVGFGVTLLGVS
LAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAFVFVGLLDFAGPVQTLLREWFGSGLRLP
RVRSTGGVILVLVLVFYPYVYLLARSAFLAQGKGLMEAARVLGQSPWQAFWRVALPMARP
AIGAGVALALMETLADFGAVSVFNFDTFTTAIYKTWYGFFSLSTAAQLASLLLLVVMVVL
YGERRARGANRASNERPRVKALYHLRGVKALAAMSWCGLVFACAFVIPVLQLMVWFWQRG
RFDLDERYAGLIIHTLYLGGIAALITVSVALVLAFARRLAPTRAIRSGISLANLGYALPG
SVLAVSIMLAFSYLDRELVIPLSGWLGGAGKPLLLGSLSALLLAYLVRFIAVAYGPLESS
LARIRPSLPEAARSLGVSGPRLFFKVYLPLLLPGTLSAALLVFVDVLKEMPATLLMRPFG
WDTLAVRIFEMTSEGEWARASLPALTLVLVGLLPVIGLIRRSAHRNA