Protein Info for Pf1N1B4_221 in Pseudomonas fluorescens FW300-N1B4

Annotation: Citronellol and citronellal dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF00106: adh_short" amino acids 16 to 201 (186 residues), 156 bits, see alignment E=1.3e-49 PF08659: KR" amino acids 18 to 127 (110 residues), 49.8 bits, see alignment E=5.8e-17 PF13561: adh_short_C2" amino acids 24 to 253 (230 residues), 173.7 bits, see alignment E=7.7e-55

Best Hits

KEGG orthology group: K13774, citronellol/citronellal dehydrogenase (inferred from 87% identity to pfo:Pfl01_3946)

Predicted SEED Role

"Citronellol and citronellal dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MHR8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Pf1N1B4_221 Citronellol and citronellal dehydrogenase (Pseudomonas fluorescens FW300-N1B4)
MAYDSIYKPDLFAGQNIIVTGGGSGIGRCTAHELAALGAQVLLVGRNAEKLKKVAAEITE
DGGKASWQVCDIRDEDAVTQLVSELIRKHGPIHGLVNNAGGQYPSPLASINQKGFETILR
TNLVGGFLMAREVFNQSMSKHGGAIVNMLADMWGGMPGMGHSGAARSGMDNFTKTAAFEW
GYAGVRVNAVAPGWVASSGMDTYEGAFRAVIPTLCEHVPLKRIGTESEISAAIVFLLSPA
AAFVSGSTLRIDGAASLGGRAWPMHKAQNSHSYNGFHRAYLPEVLRPDASKPDTSKPDEL
KDKE