Protein Info for Pf1N1B4_2206 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG139438: lipoprotein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 22 to 141 (120 residues), 60.8 bits, see alignment E=9.1e-21

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_5466)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NM14 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Pf1N1B4_2206 FIG139438: lipoprotein B (Pseudomonas fluorescens FW300-N1B4)
MLQQFLQEFGYFALFLGTFFEGETILVLAGFLAFRGYMDIKVVMLVAFLGSYAGDQLWYF
LGRKHGRKLLARKPRWQLMGDRALEHIRKHPDIWVLSFRFVYGLRTVMPVAIGLSGYPPG
RYLLLNGIGAAIWAAALASAAYHFGAVLEGMLGSVKKYELWVLGALLVLGFCLWLRRRFK
NARLAKKIYADEQALKAEQAKSSEPTTPIE