Protein Info for Pf1N1B4_2182 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutathione S-transferase N-terminal domain protein (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF02798: GST_N" amino acids 2 to 70 (69 residues), 33.6 bits, see alignment E=8.2e-12 PF13417: GST_N_3" amino acids 4 to 76 (73 residues), 61.6 bits, see alignment E=1.4e-20 PF13409: GST_N_2" amino acids 10 to 71 (62 residues), 48.1 bits, see alignment E=2.9e-16 PF14497: GST_C_3" amino acids 142 to 198 (57 residues), 21.7 bits, see alignment E=3.9e-08

Best Hits

Swiss-Prot: 65% identical to GSTE_PSEP1: Glutathione S-transferase (Pput_0205) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 81% identity to pfo:Pfl01_5490)

Predicted SEED Role

"Glutathione S-transferase N-terminal domain protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NLL6 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Pf1N1B4_2182 Glutathione S-transferase N-terminal domain protein (EC 2.5.1.18) (Pseudomonas fluorescens FW300-N1B4)
MLKLYGFCVSNYYNMVKLALLEKGLPFEEVPFYPGTTPETLAISPRGKVPVLGVERGFIN
ETSVILEYLEQSQKGTPLLSSDPFERAQVLALAKEIELYIELPGRACYAEAFFGMAVPDA
IKEKTKAELLLGFAALSRHGKFAPYVAGDSLSVADLYFLYSVPLARAVAQKLFDIDLLAE
MPAARALLERLEQNPHVQRIAKDKDAAMPAFLEMIASKK