Protein Info for Pf1N1B4_2175 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lipoprotein LppL-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 59 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13627: LPAM_2" amino acids 11 to 33 (23 residues), 36.5 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 77% identity to pfo:Pfl01_5497)

Predicted SEED Role

"Lipoprotein LppL-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NLH6 at UniProt or InterPro

Protein Sequence (59 amino acids)

>Pf1N1B4_2175 Lipoprotein LppL-related protein (Pseudomonas fluorescens FW300-N1B4)
MKRLISSLAALASLVAFVSLLSACGQKGPLYLPDENQDPAEQAKSSQQTPSKAHKHDVY