Protein Info for Pf1N1B4_2170 in Pseudomonas fluorescens FW300-N1B4

Annotation: Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00702: Hydrolase" amino acids 3 to 194 (192 residues), 82.7 bits, see alignment E=7e-27 PF13419: HAD_2" amino acids 6 to 199 (194 residues), 75.9 bits, see alignment E=6.8e-25 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 87 to 199 (113 residues), 42.8 bits, see alignment E=6e-15 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 90 to 194 (105 residues), 53.2 bits, see alignment E=4.6e-18 PF13242: Hydrolase_like" amino acids 155 to 208 (54 residues), 36.8 bits, see alignment E=4.5e-13

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 90% identity to pfo:Pfl01_5502)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NLE4 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Pf1N1B4_2170 Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase (Pseudomonas fluorescens FW300-N1B4)
MTIQLITFDLDDTLWDTAPVIASAEVILREWLTEHAPNLGAVPVEHLWSIRERVLSSEPN
LKHRISALRRRVLFHALEEAGYGHIEASDLADQGFEVFLHARHQIEVFPEVEPTLETLAK
HYALGVVTNGNADVRRLGLADYFKFALCAEDIGIAKPDARLFHEALQRGGATAETAVHIG
DHPGDDIAGAQQAGLRAIWFNPAGKVWEAQTAPDAEIRSLNELPGLLARWNTV