Protein Info for Pf1N1B4_2088 in Pseudomonas fluorescens FW300-N1B4

Annotation: ClpB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 882 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 869 (857 residues), 1165.2 bits, see alignment E=0 PF02861: Clp_N" amino acids 26 to 73 (48 residues), 23.1 bits, see alignment 3.1e-08 PF00004: AAA" amino acids 208 to 339 (132 residues), 40 bits, see alignment E=2.4e-13 amino acids 621 to 739 (119 residues), 28.8 bits, see alignment E=6.8e-10 PF17871: AAA_lid_9" amino acids 348 to 439 (92 residues), 98.6 bits, see alignment E=8.1e-32 PF07724: AAA_2" amino acids 616 to 781 (166 residues), 192 bits, see alignment E=3.7e-60 PF07728: AAA_5" amino acids 620 to 739 (120 residues), 35.8 bits, see alignment E=3.6e-12 PF10431: ClpB_D2-small" amino acids 792 to 859 (68 residues), 41.3 bits, see alignment 5.9e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 94% identity to pfo:Pfl01_5584)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NJS7 at UniProt or InterPro

Protein Sequence (882 amino acids)

>Pf1N1B4_2088 ClpB protein (Pseudomonas fluorescens FW300-N1B4)
MINVDLQQLIQALDAETRRDLESSAERCVARGGSKILVEDLLLGLLERPQGLLARALQDA
EVDAGELSAALQSRVEHSASRNPVFAPELVQWLQDALLVANLELGQSQVEQAALILALLR
NPMRYAGSRYQSLLAKLNIERLKEFALSQKEQPATGKPAVPGESLLQRFTHNLTQQARDG
KLDPVLCRDGAIRQMVDILARRRKNNPIVVGEAGVGKTAIVEGLASRIAAGEVPQVLKGV
ELLSLDMGLLQAGASVKGEFERRLKGVIDEVKASPKPIILFIDEAHTLIGAGGNAGGSDA
ANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVSEAVTILRGLAQ
VYEKSHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLERL
RGELAEGGRQRQALRRDAEAGLLIDHEALDALEDRLADAEEERVALETLWTEQKALAERL
LDLRQQLAKAREAAAVEPTITVEEDAEGTVIETLPIDEAQSVASLETALNETHRALTDAQ
VKERLVSFEVCPRLVAEVISAWTGVPLAQLAREHNAKVASFAIDLRTRIRGQEQAVHALD
RSMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGDRFITTINMSEFQEKH
TVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEKADPDVLNLFYQIFDKGVAND
GEGREIDFRNTLILMTSNLGSDRISELCENGARPTAEVLEETIRPVLSKHFKPALLARMR
VVPYYPVGGPVLRELIEIKLGRLGERLNRRQLDFTYSQDLVDHLAERCTQSDSGARLIDH
LLDLHVLPLVADRLLDAMATGESLKRVHATFDGDASVMCEFA