Protein Info for Pf1N1B4_2068 in Pseudomonas fluorescens FW300-N1B4

Annotation: Uncharacterized protein ImpJ/VasE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 424 to 442 (19 residues), see Phobius details TIGR03353: type VI secretion protein, VC_A0114 family" amino acids 5 to 443 (439 residues), 511.5 bits, see alignment E=9e-158 PF05936: T6SS_VasE" amino acids 19 to 442 (424 residues), 525.5 bits, see alignment E=5e-162

Best Hits

KEGG orthology group: K11893, type VI secretion system protein ImpJ (inferred from 95% identity to pba:PSEBR_a5554)

Predicted SEED Role

"Uncharacterized protein ImpJ/VasE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NJ78 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Pf1N1B4_2068 Uncharacterized protein ImpJ/VasE (Pseudomonas fluorescens FW300-N1B4)
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKL
AIISARGLLPDGTPFNIPQDDLAPSPLNVDDNLRDGLVYLALPLKRAGARDTVDEGEALG
AARYVSQVREVRDDNAPFENQAPVAVGSRALRLLVAQDGISDYAAIGLVRIKEKRADRAL
VLDDTYIPPLLDVVASNPLAAFRSELLGLLHQRGEALAGRVVASGAGGASEIADFMLLQL
VNRAQPLIQHLSQLSPLHPERFYSELVSLAGEFSTFTASGRRPQEYPQYQHDDLALSFAP
VMQALREALSMLIDSKATPIPIVEKAYGVHVAMLADKSLLDSASFILVVRADVPAETLRG
HFGQQSKVGSVEHIRNLVNLQLPGIGLLPLPVAPRQIPYHAGSTYYELDRGSEHWQQLAN
SGGFAFYIAGQFPGLNLAFWAIRG