Protein Info for Pf1N1B4_2042 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphate regulon metal ion transporter containing CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details PF01595: CNNM" amino acids 15 to 201 (187 residues), 172.9 bits, see alignment E=7.9e-55 PF00571: CBS" amino acids 231 to 281 (51 residues), 37.1 bits, see alignment 4.9e-13 amino acids 297 to 347 (51 residues), 28.1 bits, see alignment 3.1e-10 PF03471: CorC_HlyC" amino acids 366 to 436 (71 residues), 58.5 bits, see alignment E=8.2e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a126)

Predicted SEED Role

"Phosphate regulon metal ion transporter containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BLL7 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Pf1N1B4_2042 Phosphate regulon metal ion transporter containing CBS domains (Pseudomonas fluorescens FW300-N1B4)
LTLATIFADFGMILFALILVLLNGFFVAAEFAMVKLRSTRVEAIADKNGWRGHILRTVHS
QLDAYLSACQLGITLASLGLGWVGEPAFAHLLAPVLSAVGVDSAEVVKAVSFFTAFFIIS
YLHIVVGELAPKSWAIRKPELLSLWTAVPLYLFYWAMYPAIYLLNASANQILRIAGQGEP
GPHHEHHYSREELKLILHSSRGQDPSDQGMRVLASAVEMGELEVVDWANSREDLVTLEFN
APLKEILAMFRRHKFSRYPVYDSERQEFVGLLHIKDLLLELAALDHIPESFNLAELTRPL
ERVSRHMPLSQLLEQFRKGGSHFALVEEADGNIIGYLTMEDVLEVLVGDIQDEHRKAERG
ILAYQPGKLLVRGDTPLFKVERLLGIDLDHIEAETLAGLVYETLKRVPEEEEVLEVEGLR
IIIKKMKGPKIILAKVLMLD