Protein Info for Pf1N1B4_2034 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 3 to 309 (307 residues), 333.5 bits, see alignment E=5.1e-104 PF12849: PBP_like_2" amino acids 37 to 295 (259 residues), 131.8 bits, see alignment E=4.1e-42 PF13531: SBP_bac_11" amino acids 47 to 306 (260 residues), 29.5 bits, see alignment E=6.4e-11

Best Hits

Swiss-Prot: 85% identical to PSTS_PSEAB: Phosphate-binding protein PstS (pstS) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 96% identity to pba:PSEBR_a118)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AU03 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Pf1N1B4_2034 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1) (Pseudomonas fluorescens FW300-N1B4)
MKLKRLMAAMTFVAAGVATANAVAAVDPAIPSYTKTTGVSGNLSSVGSDTLANLMTLWAE
NYKKEYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDNELQAFETKYGYKPTAIPV
AVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCGAKTDVKTWGDLGVTGDLANKPVQLFG
RNSVSGTYGYFKEEALCKGDFKPNVNEQPGSASVVQSISSSLNGVGYSGIGYKTASVKTV
ALAKKGSTEFVEDTEENALNGKYPLSRFLYVYVNKAPNKPLAPLEAEFVKLILSKQGQEV
VVKDGYIPLPAKVAAKALADLGLQEGNNVVKK