Protein Info for Pf1N1B4_1965 in Pseudomonas fluorescens FW300-N1B4

Annotation: GDP-mannose 4,6-dehydratase (EC 4.2.1.47)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 3 to 319 (317 residues), 421.4 bits, see alignment E=1.4e-130 PF01370: Epimerase" amino acids 5 to 245 (241 residues), 210.9 bits, see alignment E=2.9e-66 PF16363: GDP_Man_Dehyd" amino acids 6 to 312 (307 residues), 431.8 bits, see alignment E=3.5e-133 PF04321: RmlD_sub_bind" amino acids 6 to 160 (155 residues), 30.1 bits, see alignment E=3.9e-11

Best Hits

Swiss-Prot: 88% identical to GM4D_PSEAE: GDP-mannose 4,6-dehydratase (gmd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 98% identity to pfo:Pfl01_5682)

MetaCyc: 88% identical to GDP-D-mannose 4,6-dehydratase subunit (Pseudomonas aeruginosa)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162ATV4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Pf1N1B4_1965 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (Pseudomonas fluorescens FW300-N1B4)
MTKSALITGITGQDGAYLAKLLLDKGYKVHGLVARRSSDSRWRLRETGIEGDIVYLDGDM
ADACSVQRAVIKSAPDEVYNLAAQSFVAASWDQPVTTGIVDGLGVTHLLEAIRQFSPHTR
FYQASTSEMFGLIQAEQQDENTPFYPRSPYGVAKLYGHWITVNYRESFNLHASSGILFNH
ESPLRGIEFVTRKVTDAAARIKQGKQQELRLGNIDAKRDWGFAGDYVEAMWLMLQQDTPD
DYVVATGVTTTVREMCRIAFDHIGLNYRDYVKIDPAFFRPAEVEVLLGNPAKAQRVLGWK
PKTDLDTLIRMMMDADIKRVAKE