Protein Info for Pf1N1B4_1965 in Pseudomonas fluorescens FW300-N1B4

Annotation: GDP-mannose 4,6-dehydratase (EC 4.2.1.47)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 3 to 319 (317 residues), 421.4 bits, E=1.4e-130
• PF01370: Epimerase
  • amino acids 5 to 245 (241 residues), 210.9 bits, E=2.9e-66
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 312 (307 residues), 431.8 bits, E=3.5e-133
• PF04321: RmlD_sub_bind
  • amino acids 6 to 160 (155 residues), 30.1 bits, E=3.9e-11

Best Hits

Swiss-Prot: 88% identical to GM4D_PSEAE: GDP-mannose 4,6-dehydratase (gmd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 98% identity to pfo:Pfl01_5682)

MetaCyc: 88% identical to GDP-D-mannose 4,6-dehydratase subunit (Pseudomonas aeruginosa)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-perosamine biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (7/14 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

See A0A162ATV4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Pf1N1B4_1965 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (Pseudomonas fluorescens FW300-N1B4)
MTKSALITGITGQDGAYLAKLLLDKGYKVHGLVARRSSDSRWRLRETGIEGDIVYLDGDM
ADACSVQRAVIKSAPDEVYNLAAQSFVAASWDQPVTTGIVDGLGVTHLLEAIRQFSPHTR
FYQASTSEMFGLIQAEQQDENTPFYPRSPYGVAKLYGHWITVNYRESFNLHASSGILFNH
ESPLRGIEFVTRKVTDAAARIKQGKQQELRLGNIDAKRDWGFAGDYVEAMWLMLQQDTPD
DYVVATGVTTTVREMCRIAFDHIGLNYRDYVKIDPAFFRPAEVEVLLGNPAKAQRVLGWK
PKTDLDTLIRMMMDADIKRVAKE