Protein Info for Pf1N1B4_1955 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 4 to 76 (73 residues), 61.8 bits, E=1.9e-20
• PF13417: GST_N_3
  • amino acids 6 to 80 (75 residues), 47.5 bits, E=5.3e-16
• PF13409: GST_N_2
  • amino acids 12 to 76 (65 residues), 58.8 bits, E=2e-19
• PF13410: GST_C_2
  • amino acids 126 to 187 (62 residues), 35.1 bits, E=3.6e-12
• PF14497: GST_C_3
  • amino acids 133 to 193 (61 residues), 26.4 bits, E=2e-09
• PF00043: GST_C
  • amino acids 135 to 192 (58 residues), 34.5 bits, E=5.9e-12

Best Hits

Swiss-Prot: 64% identical to GSTA_RHILE: Protein GstA (gstA) from Rhizobium leguminosarum

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 83% identity to pfo:Pfl01_5690)

Predicted SEED Role

"Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A161Z241 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Pf1N1B4_1955 Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18) (Pseudomonas fluorescens FW300-N1B4)
MQAIKLYNFPRSGHAHRVELMLALLQLPTELIFVDLAKGAHKQADFLALNPFGQVPVIDD
QGVVLADSNAILVYLALKYGNGRWLPTDPVGAAKVQRWLSVAAGPIAFGPGRARLITVFG
APYNAQEVIAYAHSWLKVIDQELGATAYLAGGEPTIADIAAYSYIAHAPEGNVSLDDYPN
IRAWLARVEVLPGFVGMPRTVAGLQKTA