Protein Info for Pf1N1B4_1929 in Pseudomonas fluorescens FW300-N1B4

Annotation: Chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF11638: DnaA_N" amino acids 2 to 62 (61 residues), 73.1 bits, see alignment E=3e-24 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 4 to 502 (499 residues), 632.3 bits, see alignment E=2.5e-194 PF00308: Bac_DnaA" amino acids 169 to 329 (161 residues), 253.3 bits, see alignment E=3e-79 PF01695: IstB_IS21" amino acids 205 to 307 (103 residues), 25.5 bits, see alignment E=2.3e-09 PF00004: AAA" amino acids 206 to 316 (111 residues), 25.6 bits, see alignment E=3.6e-09 PF08299: Bac_DnaA_C" amino acids 413 to 481 (69 residues), 109.5 bits, see alignment E=1.7e-35

Best Hits

Swiss-Prot: 96% identical to DNAA_PSEPF: Chromosomal replication initiator protein DnaA (dnaA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 97% identity to pba:PSEBR_a1)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NGK8 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Pf1N1B4_1929 Chromosomal replication initiator protein DnaA (Pseudomonas fluorescens FW300-N1B4)
VELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLGRVLEL
LDEHGNGLAPALSLLIGSKRSSAPRAAPNAPLAAAASQAQAAQAPVSAPAPAPAAASTKR
ATQKVAEVSEEPSRDSFDPMAGASSQQAPVRSEQRTVQVEGALKHTSYLNRTFTFENFVE
GKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYLHS
ERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGGQQ
VILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVDLPHDAAF
FIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDKLVSVDNIQRTV
AEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDVFGGRDHTTVLHACRK
INELKESDADIREDYKNLLRTLTT