Protein Info for Pf1N1B4_1921 in Pseudomonas fluorescens FW300-N1B4

Annotation: D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR01662: HAD hydrolase, family IIIA" amino acids 2 to 146 (145 residues), 121.6 bits, see alignment E=2.6e-39 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 2 to 145 (144 residues), 147.1 bits, see alignment E=3.6e-47 PF00702: Hydrolase" amino acids 13 to 138 (126 residues), 41.9 bits, see alignment E=3e-14 PF08645: PNK3P" amino acids 21 to 130 (110 residues), 38.1 bits, see alignment E=2.7e-13 PF13242: Hydrolase_like" amino acids 99 to 169 (71 residues), 54.2 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 81% identical to GMHBB_PSEAE: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 93% identity to pfo:Pfl01_0008)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NGE8 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf1N1B4_1921 D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15) (Pseudomonas fluorescens FW300-N1B4)
LKLLILDRDGVINYDSDAYIKSVEEWIPLPGSIEAIAQLSKAGWTVAVATNQSGIARGYY
DIATLDAMHARLRELVAEQGGEVGLIVYCPHGPDDGCDCRKPKPGMLKTIAAHYNVSLTN
LWFVGDTLGDLEAAKAVDCQPVLVKTGKGEKTQGKTLPAGTLIFDDLAAIAAELIHN