Protein Info for Pf1N1B4_1912 in Pseudomonas fluorescens FW300-N1B4

Annotation: Peptide deformylase (EC 3.5.1.88)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF01327: Pep_deformylase" amino acids 4 to 153 (150 residues), 184.8 bits, see alignment E=4.1e-59 TIGR00079: peptide deformylase" amino acids 4 to 161 (158 residues), 187.5 bits, see alignment E=6.4e-60

Best Hits

Swiss-Prot: 91% identical to DEF_PSEU5: Peptide deformylase (def) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 97% identity to pba:PSEBR_a74)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162ATN5 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Pf1N1B4_1912 Peptide deformylase (EC 3.5.1.88) (Pseudomonas fluorescens FW300-N1B4)
MAILDILEFPDSRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGIGLAATQVNVHKRIVV
MDLSEDRSEPRVFINPEFEVLTDEVDQYQEGCLSVPGFYENVDRPQKVKIKAQDRDGQPY
ELIAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKLHRQNA