Protein Info for Pf1N1B4_1883 in Pseudomonas fluorescens FW300-N1B4

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 249 to 272 (24 residues), see Phobius details PF12792: CSS-motif" amino acids 48 to 243 (196 residues), 90.8 bits, see alignment E=8.8e-30 PF00563: EAL" amino acids 281 to 512 (232 residues), 211.7 bits, see alignment E=1.1e-66

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_0048)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z1Z6 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Pf1N1B4_1883 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Pseudomonas fluorescens FW300-N1B4)
MMPAARERLHSWFYRPWFLAMLATALSATLLTVGSLFVAMHQVEQNESQEMNAQGERFLV
RLEQLFGQLRESLDDLQAQPLRGCDDEMIATLQQVSFNYRFVYEAAYMDTARTCSNRPRQ
EGVSLIRPPDIKGPIYSYWLNTTTEPDENRAALMLGRGNFRVATSRGHLTDMVDLSPGSS
LLVVLDHGTRAIPVLGVAQAWPPTEPWPPKSPDALQVTPTRLIYRMPTNTREYQLVLITP
RTGMHVPAVWWWLLPASLALSACVGILVFLLVRQRQSLDAELQGAMRRGELQVLYQPIFD
LDSRNCVGAEALLRWRRPDGTLTSPDLFIPMAENTGQIRQMTDFVLQRLLEQLGQLLRSN
PQLYISVNLAACDVMVPRIGQVMARLLSMHRVAARQIAFEVTERGLVDVVVARENLQALR
DVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAFIDALGHDAASSGVAPHIIRMAQALQ
LKVIAEGIEHEAQAVFLSSEGVKFGQGWLFAHALSAVQFIELITRGRRLTTRRQDDEA