Protein Info for Pf1N1B4_1873 in Pseudomonas fluorescens FW300-N1B4

Annotation: Homoserine kinase (EC 2.7.1.39)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00938: homoserine kinase" amino acids 1 to 302 (302 residues), 291.6 bits, see alignment E=3.8e-91 PF01636: APH" amino acids 27 to 255 (229 residues), 150.4 bits, see alignment E=3.9e-48

Best Hits

Swiss-Prot: 71% identical to KHSE_PSEAE: Homoserine kinase (thrB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 91% identity to pfl:PFL_0080)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z1Y9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Pf1N1B4_1873 Homoserine kinase (EC 2.7.1.39) (Pseudomonas fluorescens FW300-N1B4)
MSVFTPLARPELETFLAPYGLGRLLDFQGIAAGSENTNFFISLEQGEFVLTLVERGPVQE
MPFFIELLDVLHDANLPVPYALRTTDGVALRELAGKPALLQPRLAGKHIKDANAQHCAQV
GELLAHLHLATQANMIKRKTDRGLDWMLEEGTQLLSHLNAEQSDLLQRALDEITQQKTKI
LALPRANIHADLFRDNAMFEGTHLTGLIDFYNACSGPMLYDVAIALNDWCSDEQGQLDGA
RARALLGAYAALRPFTAAEAELWPTMLRVACVRFWLSRLIAAESFAGQDVLIHDPMEFQL
RLMQRQKVHTPLPFAL