Protein Info for Pf1N1B4_1837 in Pseudomonas fluorescens FW300-N1B4

Annotation: Osmotically inducible protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03562: peroxiredoxin, OsmC subfamily
  • amino acids 4 to 139 (136 residues), 202.4 bits, E=1.4e-64
• PF02566: OsmC
  • amino acids 42 to 137 (96 residues), 74.8 bits, E=3.2e-25

Best Hits

Swiss-Prot: 60% identical to OSMC_SHIFL: Peroxiredoxin OsmC (osmC) from Shigella flexneri

KEGG orthology group: K04063, osmotically inducible protein OsmC (inferred from 96% identity to pfo:Pfl01_0097)

MetaCyc: 60% identical to osmotically inducible peroxiredoxin OsmC (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Osmotically inducible protein C"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24

Sequence Analysis Tools

See A0A166NER7 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Pf1N1B4_1837 Osmotically inducible protein C (Pseudomonas fluorescens FW300-N1B4)
MAITKKASAHWEGDLKTGIGSISTETGVLRDAPYGFKARFEGGKGTNPEELIGAAHAGCF
SMAFSMILGEANLKADSIDTNAEVTLDQVDGGFAITAVKLILKAKIPGATQAQFEELSNK
AKEGCPVSKVLNAKISLDATLVS