Protein Info for Pf1N1B4_1834 in Pseudomonas fluorescens FW300-N1B4

Annotation: Dodecin (COG3360) Flavin-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 71 PF07311: Dodecin" amino acids 6 to 68 (63 residues), 103.5 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 56% identical to DODEC_HALHL: Dodecin (Hhal_0546) from Halorhodospira halophila (strain DSM 244 / SL1)

KEGG orthology group: K09165, hypothetical protein (inferred from 94% identity to pfo:Pfl01_0100)

Predicted SEED Role

"Dodecin (COG3360) Flavin-binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z6Q1 at UniProt or InterPro

Protein Sequence (71 amino acids)

>Pf1N1B4_1834 Dodecin (COG3360) Flavin-binding (Pseudomonas fluorescens FW300-N1B4)
MTDHHTYKKVELVGSSTTSIEDAINNALAEANKSLKYMEWFEVTETRGHIKDGKAAHFQV
TLKVGFRIASS