Protein Info for Pf1N1B4_1788 in Pseudomonas fluorescens FW300-N1B4

Annotation: putative 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20791: Acyl-ACP_TE_C
  • amino acids 12 to 39 (28 residues), 21.8 bits, 2.8e-08
• PF13279: 4HBT_2
  • amino acids 20 to 138 (119 residues), 69.9 bits, E=4.1e-23
• PF03061: 4HBT
  • amino acids 27 to 108 (82 residues), 52.2 bits, E=9.5e-18

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 90% identity to pfo:Pfl01_0277)

Predicted SEED Role

"putative 4-hydroxybenzoyl-CoA thioesterase" in subsystem Gentisare degradation

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See A0A166NDT8 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Pf1N1B4_1788 putative 4-hydroxybenzoyl-CoA thioesterase (Pseudomonas fluorescens FW300-N1B4)
MSNPMPQRTDYPHFQPITTRWHDNDTYGHVNNVTYYSFFDTAVNTYLIEVGGLDIHDGEV
VGFVVSSACDYFASIAFPDRIEIGLRVDKLGNSSVQYELAVFKAGEDDACAAGRFVHVFV
DRTTNQPVAIPAGLRGALERLAI