Protein Info for Pf1N1B4_1770 in Pseudomonas fluorescens FW300-N1B4

Annotation: Uncharacterized protein, possibly involved in aromatic compounds catabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14539: DUF4442
  • amino acids 11 to 124 (114 residues), 38.5 bits, E=1.9e-13
• TIGR00369: uncharacterized domain 1
  • amino acids 12 to 125 (114 residues), 82 bits, E=1.7e-27
• PF13622: 4HBT_3
  • amino acids 41 to 125 (85 residues), 43.7 bits, E=4.1e-15
• PF03061: 4HBT
  • amino acids 42 to 116 (75 residues), 67.1 bits, E=2.1e-22

Best Hits

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 95% identity to pfo:Pfl01_0258)

Predicted SEED Role

"Uncharacterized protein, possibly involved in aromatic compounds catabolism"

Sequence Analysis Tools

See A0A166NDJ0 at UniProt or InterPro

Protein Sequence (127 amino acids)

>Pf1N1B4_1770 Uncharacterized protein, possibly involved in aromatic compounds catabolism (Pseudomonas fluorescens FW300-N1B4)
MEIPAGLTESAFFKLLGCRLHSLETGVAQVALALEPELRNRGGKLHGGALFSLVDIAMGL
ACSSTHGFDQQSATIECKINYIRAVADGEVMCTARVIHPGRRTLVVEADVMQGDKLVAKA
QGTFAVL