Protein Info for Pf1N1B4_1751 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG00960943: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 PF10982: DUF2789" amino acids 1 to 75 (75 residues), 108 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfl:PFL_0152)

Predicted SEED Role

"FIG00960943: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166ND39 at UniProt or InterPro

Protein Sequence (81 amino acids)

>Pf1N1B4_1751 FIG00960943: hypothetical protein (Pseudomonas fluorescens FW300-N1B4)
MESPTHSLPSLFKQLGLPDDAESIDKFIATHSPLKPELHLADAFFWSESQAELLREEILD
DADWAEVVDQLDVLLRKGRGV